SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000032036 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000032036
Domain Number 1 Region: 1576-1811
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.31e-79
Family Eukaryotic proteases 0.00000002
Further Details:      
 
Domain Number 2 Region: 1376-1480
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-39
Family Kringle modules 0.00000641
Further Details:      
 
Domain Number 3 Region: 813-914
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-38
Family Kringle modules 0.00000607
Further Details:      
 
Domain Number 4 Region: 1149-1252
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-38
Family Kringle modules 0.0000035
Further Details:      
 
Domain Number 5 Region: 1034-1138
Classification Level Classification E-value
Superfamily Kringle-like 9.91e-38
Family Kringle modules 0.00000178
Further Details:      
 
Domain Number 6 Region: 1265-1366
Classification Level Classification E-value
Superfamily Kringle-like 9.91e-38
Family Kringle modules 0.0000105
Further Details:      
 
Domain Number 7 Region: 358-461
Classification Level Classification E-value
Superfamily Kringle-like 1.26e-37
Family Kringle modules 0.00000992
Further Details:      
 
Domain Number 8 Region: 700-803
Classification Level Classification E-value
Superfamily Kringle-like 1.67e-37
Family Kringle modules 0.0000142
Further Details:      
 
Domain Number 9 Region: 929-1029
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-37
Family Kringle modules 0.00000121
Further Details:      
 
Domain Number 10 Region: 130-234
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-37
Family Kringle modules 0.0000105
Further Details:      
 
Domain Number 11 Region: 19-120
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-37
Family Kringle modules 0.000015
Further Details:      
 
Domain Number 12 Region: 244-348
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-37
Family Kringle modules 0.0000105
Further Details:      
 
Domain Number 13 Region: 587-689
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-37
Family Kringle modules 0.0000114
Further Details:      
 
Domain Number 14 Region: 473-575
Classification Level Classification E-value
Superfamily Kringle-like 1.98e-36
Family Kringle modules 0.0000129
Further Details:      
 
Domain Number 15 Region: 1474-1574
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-33
Family Kringle modules 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000032036   Gene: ENSPTRG00000018770   Transcript: ENSPTRT00000034657
Sequence length 1812
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:162310773:162446680:-1 gene:ENSPTRG00000018770 transcript:ENSPTRT00000034657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHKEVVLLLLLFLKSAAPEQSHVVQDCYHGDGQSYRGTYSTTVTGRTCQAWSSMTPHQH
NRTTENYPNAGLIMNYCRNPDPVAAPYCYTTDPSVRREYCNLTQCSDAEGTAIVPPTVTP
VPSLEALSEQAPTEQRPGVQECYHGNGHSYRGTYSTTVTGRTCQAWSSRTPHSHRRTPEY
YPNAGLIMNYCRNPDPVAAPYCYTTDPSVRWEYCNLTQCSEAEGTAVAPPTVTPVPSLEA
PSEQAPTEQRPGVQECYHGNGHSYRGTYSTTVTGRTCQAWSSRTPHSHRRTPEYYPNAGL
IMNYCRNPDPVAAPYCYTTDPSVRWEYCNLTQCSEAEGTAVAPPTVTPVPSLEAPSEQAP
TEQRPEVQECYHGNGHSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCR
NPDPVAAPYCYTMDPSVRWEYCNLTQCSDAEGTAVAPPTVTPLPSLEALSEQAPTKQRPG
VQECYHGNGHSYRGTYFKTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDPVA
APYCYTTDPSVRWEYCNLTQCSDAEGTAVAPPTVTPLPSLEAPSEQAPTKQRPGVQECYH
GNGHGYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDPVAAPYCYT
TDPSVRWEYCNLTQCSDAEGTAVAPPTITPVRSLEAPSEQAPTEQRPGVQECYHGNGQSY
RGTYFITVTGRTCQAWSSMTPHSHSRTPAYYPNAGLIKNYCRNPDPVAAPWCYTTDPSVR
WEYCNLTRCSDAEWTAFIPPNVIPAPSLEAFFEQAPTEETPGVRDCYYHYGQSYRGTYST
TVTGRTCQAWSSMTPHQHSRTPENYPNAGLTRNYCRNPDAEIRPWCYTRDPSVRWEYCNL
TQCLVTESSVLATLTVVPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRT
CQSWSSMTPHWHQRTTEYYPNGGLTRNYCRNPDAEISPWCYTMDPNVRWEYCNLTQCPVT
ESSVLATSMAVSEQAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWHQR
TTEYYPNGGLTRNYCRNPDAEIRPWCYTMDPSVRWEYCNLTQCPVMESTVLTNPTVVPVP
STEVPSEEAPTENSPGVQDCYRGDGQSYRGTLSTTITGRTCQSWSSMTPHWHRRIPLYYP
NAGLARNYCRNPDAEIRPWCYTLDPSVRWEYCNLTQCPVTESSVLTTPTVAPVPSTEAAS
EQAPPKKSPVVQDCYHGDGRSYRGISSTTVTGRTCQSWSSMIPHWHQRTPENYPNAGLTG
NYCRNPDSGKQPWCYTTDPCVRWEYCNLTQCSETESGVLETPTVVPVPSMEAHSEAAPTE
QTPVVRQCYHGNGQSYRGTFSTTVTGRTCQSWSSMTPHQHQRTPENYPNDGLTMNYCRNP
DANTGPWCFTTDPSVRWEYCNLTRCSDTEGTVVAPPTVIQVPSLEAPSEQDCMFGNGKGY
RGKKATTVTGTPCQEWAAQEPHRHSKFIPGTSKWAGLEKNYCRNPDGDINGPWCYTMNPR
KLFDYCDIPLCASSSFDCGKPQVEPKKCPGSIVGGCVAHPHSWPWQVSLRTRFGKHFCGG
TLISPEWVLTAAHCLKKSSRPSSYKVILGAHQEVNLESHVQEIEVSRLFLEPTQADIALL
KLSRPAVITDKVMPACLPSPDYMVTARTECYITGWGETQGTFGTGLLKEAQLLVIENEVC
NQYKYICAEHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYARVSR
FVTWIEGMMRNN
Download sequence
Identical sequences 9598.ENSPTRP00000032036 ENSPTRP00000032036 ENSPTRP00000032036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]