SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000032051 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000032051
Domain Number 1 Region: 566-809
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.37e-83
Family Eukaryotic proteases 0.00000000579
Further Details:      
 
Domain Number 2 Region: 366-468
Classification Level Classification E-value
Superfamily Kringle-like 1.86e-39
Family Kringle modules 0.00000568
Further Details:      
 
Domain Number 3 Region: 90-183
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-36
Family Kringle modules 0.00000635
Further Details:      
 
Domain Number 4 Region: 273-358
Classification Level Classification E-value
Superfamily Kringle-like 1.93e-35
Family Kringle modules 0.0000053
Further Details:      
 
Domain Number 5 Region: 464-563
Classification Level Classification E-value
Superfamily Kringle-like 1.43e-34
Family Kringle modules 0.00000497
Further Details:      
 
Domain Number 6 Region: 183-266
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-34
Family Kringle modules 0.00000504
Further Details:      
 
Domain Number 7 Region: 19-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 4.71e-21
Family Hairpin loop containing domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000032051   Gene: ENSPTRG00000018774   Transcript: ENSPTRT00000034673
Sequence length 810
Comment pep:novel chromosome:CHIMP2.1.4:6:162491956:162543451:1 gene:ENSPTRG00000018774 transcript:ENSPTRT00000034673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDKEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDGE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSLVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVQLPNVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCASPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RLGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVKLEPHVQEIEVSRLFLE
PTRTDIALLKLSSPAIITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRNEFLNGRVKSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Download sequence
Identical sequences A0A2J8JZZ2
ENSPTRP00000032051 ENSPTRP00000032051 9598.ENSPTRP00000032051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]