SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000032523 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000032523
Domain Number 1 Region: 11-134
Classification Level Classification E-value
Superfamily FKBP-like 1e-33
Family FKBP immunophilin/proline isomerase 0.00019
Further Details:      
 
Domain Number 2 Region: 112-205
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000391
Family Calbindin D9K 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000032523   Gene: ENSPTRG00000019035   Transcript: ENSPTRT00000035183
Sequence length 211
Comment pep:known chromosome:CHIMP2.1.4:7:28583045:28596403:-1 gene:ENSPTRG00000019035 transcript:ENSPTRT00000035183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDG
SLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHH
DALVEDIFDKEDEDKDGFISAREFTYKHDEL
Download sequence
Identical sequences A0A090N7V8 G3RF27 H2QUC7 Q5R941 Q9NWM8
ENSP00000222803 ENSPTRP00000032523 9598.ENSPTRP00000032523 9606.ENSP00000222803 ENSGGOP00000014183 gi|8923659|ref|NP_060416.1| ENSGGOP00000014183 ENSP00000222803 ENSP00000222803 NP_060416.1.87134 NP_060416.1.92137 XP_004045292.1.27298 XP_519022.2.37143 ENSPTRP00000032523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]