SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033329 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033329
Domain Number 1 Region: 10-87
Classification Level Classification E-value
Superfamily Histone-fold 3.67e-16
Family TBP-associated factors, TAFs 0.0031
Further Details:      
 
Domain Number 2 Region: 226-402
Classification Level Classification E-value
Superfamily ARM repeat 0.000048
Family GUN4-associated domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033329   Gene: ENSPTRG00000019474   Transcript: ENSPTRT00000036055
Sequence length 677
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:100718147:100730101:-1 gene:ENSPTRG00000019474 transcript:ENSPTRT00000036055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHM
GKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINT
PLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKG
KGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRA
EALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKY
VHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFT
KSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGA
DHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRT
TLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIV
MSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGP
GSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGT
PKANGSQSNSGSPQPAP
Download sequence
Identical sequences H2QV18
ENSPTRP00000033329 XP_001139475.2.37143 XP_008967005.1.60992 XP_008967006.1.60992 XP_008967007.1.60992 XP_009452025.1.37143 ENSPTRP00000033329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]