SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034325 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034325
Domain Number 1 Region: 16-121
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.7e-33
Family Nucleoplasmin-like core domain 0.0000608
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000034325
Domain Number - Region: 125-153
Classification Level Classification E-value
Superfamily ARM repeat 0.0239
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034325   Gene: ENSPTRG00000020045   Transcript: ENSPTRT00000037143
Sequence length 213
Comment pep:known_by_projection chromosome:CHIMP2.1.4:8:18219136:18231184:1 gene:ENSPTRG00000020045 transcript:ENSPTRT00000037143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMH
RVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQER
YEASDLTWEEEEEEEGEEEEEEEEDDEDEDADVSLEESPVKQVKRLVPQKQASVAKKKKL
EKEEEEIRASVRDKSPVKKAKATARAKKPGFKK
Download sequence
Identical sequences H2QVU2
XP_001151503.1.37143 ENSPTRP00000034325 9598.ENSPTRP00000034325 ENSPTRP00000034325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]