SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034874 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034874
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.89e-98
Family Carbonic anhydrase 0.0000000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034874   Gene: ENSPTRG00000020386   Transcript: ENSPTRT00000037731
Sequence length 262
Comment pep:known chromosome:CHIMP2.1.4:8:83370482:83407993:1 gene:ENSPTRG00000020386 transcript:ENSPTRT00000037731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQFHLHWGSADDHGSEHIVDGVSYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNF
DPLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFH
Download sequence
Identical sequences H2QWD3
XP_001169377.1.37143 XP_003831299.1.60992 ENSPTRP00000034874 9598.ENSPTRP00000034874 ENSPTRP00000034874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]