SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035262 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035262
Domain Number 1 Region: 27-96
Classification Level Classification E-value
Superfamily Histone-fold 2.86e-20
Family TBP-associated factors, TAFs 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035262   Gene: ENSPTRG00000020621   Transcript: ENSPTRT00000038138
Sequence length 129
Comment pep:known_by_projection chromosome:CHIMP2.1.4:8:139274677:139278425:1 gene:ENSPTRG00000020621 transcript:ENSPTRT00000038138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVSWVKTRGGEQRLRFLPLRIRVIMKSSPHVSSINQEALVLTAKATELFVQCLATYSY
RHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDENDNDN
ESDHDEADS
Download sequence
Identical sequences ENSPTRP00000035262 ENSPTRP00000035262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]