SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036064 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036064
Domain Number 1 Region: 410-712
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.58e-72
Family Protein kinases, catalytic subunit 0.000000459
Further Details:      
 
Domain Number 2 Region: 247-369
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-35
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 35-123
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-21
Family I set domains 0.027
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000036064
Domain Number - Region: 141-228
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0366
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036064   Gene: ENSPTRG00000021101   Transcript: ENSPTRT00000039028
Sequence length 910
Comment pep:known chromosome:CHIMP2.1.4:9:90526504:90685454:-1 gene:ENSPTRG00000021101 transcript:ENSPTRT00000039028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNV
RWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKTITATGVLFVR
LGPTHSPNHNFQDDYHEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTMI
GTSTHLSDQCSQFAIPSFCHFVFPLCDARSRAPKPRELCRDECEVLESDLCRQEYTIARS
NPLILMRLQLPKCEALPMPESPDAANCMRIGIPAERLGRYHQCYNGSGMDYRGTASTTKS
GHQCQPWALQHPHSHHLSSTDFPELGGGHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPS
CSPRDSSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASTPQRRQLMASPSQDME
MPLINQHKQAKLKEISLSAVRFMEELGEDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKA
EGPLREEFRHEAMLRARLQHPNIVCLLGVVTKDQPLSMIFSYCLHGDLHEFLVMRSPHSD
VGSTDDDRTVKSALEPPDFVHLVAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLNVKISD
LGLFREVYAADYYKLLGNSLLPIRWMAPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPY
CGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRAWGNLS
NYNSSAQTSGASNTTQTSSLSTSPVSNVSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVP
PPQLYIPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGY
VTTAPSNTSMADRAALLSEGADDTQNAPEDGAQSPVQEAEEEEEGSVPETELLGDCDTLQ
VDEAQVQLEA
Download sequence
Identical sequences ENSPTRP00000036065 ENSPTRP00000036064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]