SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036348 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036348
Domain Number 1 Region: 6-139
Classification Level Classification E-value
Superfamily Histone-fold 4.76e-34
Family TBP-associated factors, TAFs 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036348   Gene: ENSPTRG00000021280   Transcript: ENSPTRT00000039337
Sequence length 147
Comment pep:known chromosome:CHIMP2.1.4:9:112343816:112346952:-1 gene:ENSPTRG00000021280 transcript:ENSPTRT00000039337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK
RKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQD
KSRDEDNDEDEERLEEEEQNEEEEVDN
Download sequence
Identical sequences A0A024R829 A0A0D9RJ77 A0A212CN04 A0A2J8WRX2 A0A2K5DGQ8 A0A2K5HSW4 A0A2K5NWD2 A0A2K5RX40 A0A2K5YRF9 A0A2K6DZM7 A0A2K6MTL7 A0A2K6Q9X0 A0A2K6UY63 F7EVY7 G1S438 G2HEE7 G3QRK2 G7PRM1 Q3SZN5 Q5R4W3 Q9NRF9 W5P8E2
ENSOARP00000006697 ENSMMUP00000009409 ENSPTRP00000036348 ENSP00000363284 ENSP00000363286 ENSNLEP00000020276 ENSNLEP00000020276 ENSPTRP00000036348 ENSPPYP00000021877 NP_001029562.1.59421 NP_001029562.1.76553 NP_001126884.1.23681 NP_001233445.1.37143 NP_001244786.1.72884 NP_001265184.1.87134 NP_001265184.1.92137 NP_001270815.1.63531 NP_059139.3.87134 NP_059139.3.92137 XP_003264080.1.23891 XP_003925260.1.74449 XP_004004040.1.66739 XP_004048524.1.27298 XP_005684384.1.57651 XP_005976127.1.78601 XP_006061286.1.26621 XP_007966542.1.81039 XP_010368780.1.97406 XP_010833464.1.44457 XP_011748653.1.29376 XP_011805488.1.43180 XP_011853893.1.47321 XP_011947819.1.92194 XP_012007600.1.54773 XP_012317307.1.9421 XP_012364491.1.23891 XP_012624326.1.48125 XP_012624327.1.48125 XP_017385817.1.71028 XP_017731458.1.44346 XP_019822325.1.53367 ENSP00000363284 ENSPPYP00000021877 ENSGGOP00000005257 gi|224586804|ref|NP_059139.3| ENSP00000363284 ENSP00000363286 ENSBTAP00000000316 ENSBTAP00000000316 ENSMMUP00000009409 ENSGGOP00000005257 9544.ENSMMUP00000009409 9598.ENSPTRP00000036348 9600.ENSPPYP00000021877 9606.ENSP00000363284 9913.ENSBTAP00000000316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]