SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036501 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000036501
Domain Number - Region: 394-641
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00942
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036501   Gene: ENSPTRG00000021359   Transcript: ENSPTRT00000039507
Sequence length 652
Comment pep:known chromosome:CHIMP2.1.4:9:123845397:123879629:1 gene:ENSPTRG00000021359 transcript:ENSPTRT00000039507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALPPRPLLLLPLVLLLSGRPARADSKVFGDLDQVRMTSEGSDCRCKCIMRPLSKDA
CSRVRSGRARVEDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQ
SMVDLLEGTLYSMDLMKVHAYVHKVASQMNTLEESIKANLSRENEVVKDSVRHLSEQLRH
YENHSAIMLGIKKELSRLGLQLLQKDAAAAPATPATGAGSKAQDTAGGKGKDISKYGSVQ
KSFADRGLPKPPKEKLLQVEKLRKESGKGRFLQPTAKPRALAQQQAVIRGFTYYKAGKQE
VTEAVADNALQGTSWLEQLPPKVEGRSNSAEPNSAEQDEAEPRSSERVDLASGTPTSIPA
TTTTATTTPTPTTSLLPTEPPSGPEVSSQGREASCEGTLRAVDPPVRHHSYGRHEGAWMK
DPAARDDRIYVTNYYYGNSLVEFRNLENFKQGRWSNMYKLPYNWIGTGHVVYQGAFYYNR
AFTKNIIKYDLRQRFVASWALLPDVVYEDTTPWKWRGHSDIDFAVDESGLWVIYPAVDDR
DEAQPEVIVLSRLDPGDLSVHRETTWKTQLRRNSYGNCFLVCGILYAVDTYNQQEGQVAY
AFDTHTGTDARPQLPFLNEHSYTTQIDYNPKERVLYAWDNGHQLTYTLHFVV
Download sequence
Identical sequences K6ZWX9
ENSPTRP00000036501 9598.ENSPTRP00000036501 ENSPTRP00000036501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]