SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000037381 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000037381
Domain Number 1 Region: 6-115
Classification Level Classification E-value
Superfamily Histone-fold 1.84e-18
Family Nucleosome core histones 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000037381   Gene: ENSPTRG00000021794   Transcript: ENSPTRT00000040456
Sequence length 117
Comment pep:known_by_projection chromosome:CHIMP2.1.4:X:38338846:38339271:1 gene:ENSPTRG00000021794 transcript:ENSPTRT00000040456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKKNCKNSSTNNNQTQDPSRNELQVPMSFVDRVVQDERDVQSQSSSTINTLLTLLDCL
ADYIMERVGLEASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND
Download sequence
Identical sequences H2QYG4
9598.ENSPTRP00000037381 ENSPTRP00000037381 ENSPTRP00000037381 XP_003317470.1.37143 XP_003815438.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]