SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000038856 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000038856
Domain Number 1 Region: 32-74
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000865
Family TBP-associated factors, TAFs 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000038856   Gene: ENSPTRG00000023965   Transcript: ENSPTRT00000046761
Sequence length 124
Comment pep:known chromosome:CHIMP2.1.4:1:109796990:109808376:-1 gene:ENSPTRG00000023965 transcript:ENSPTRT00000046761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDL
VIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEA
NYGS
Download sequence
Identical sequences A0A024R089 A0A091CX57 A0A0D9S6K1 A0A1S3GEW5 A0A250XV03 A0A287DCG3 A0A2J8UMP0 A0A2K5E0Q7 A0A2K5PJR6 A0A2K6DSE8 A0A2K6GNA2 A0A2K6QRX9 A0A2K6S8V2 B2RYQ7 F6UZE5 G1LD05 G1QPF7 G3IC75 G3R267 G3T7G4 H2QZD7 H9EQD2 I7G8Y8 L5K2R6 L5LXB1 M3XUK6 P61216 Q148M7 Q15543 Q5R9W6 W5QCJ9
ENSPCAP00000005317 ENSOCUP00000020136 ENSAMEP00000004786 ENSLAFP00000009547 ENSRNOP00000027530 ENSNLEP00000002823 ENSDNOP00000014143 ENSMUSP00000121346 ENSMUSP00000121346 NP_001069065.1.59421 NP_001069065.1.76553 NP_001125848.1.23681 NP_001270388.1.63531 NP_001290545.1.100692 NP_001290545.1.4139 NP_005636.1.87134 NP_005636.1.92137 NP_079720.1.92730 XP_001146772.1.37143 XP_002715858.1.1745 XP_002751215.1.60252 XP_002919244.1.58354 XP_003267935.1.23891 XP_003409589.1.64505 XP_003512530.1.69978 XP_003808385.1.60992 XP_003933445.1.74449 XP_004002318.1.66739 XP_004407254.1.74151 XP_004420796.1.5094 XP_004449031.1.11602 XP_004582041.1.84141 XP_004620105.1.94378 XP_004689764.1.23501 XP_004769732.1.14098 XP_005338125.1.77405 XP_005388901.1.28644 XP_005542548.1.63531 XP_005678025.1.57651 XP_005891388.1.15283 XP_005976805.1.78601 XP_006052217.1.26621 XP_006149574.1.99106 XP_006763022.1.95426 XP_006919649.1.64745 XP_006979525.1.50099 XP_007106514.1.24612 XP_007169541.1.59432 XP_007449392.1.90284 XP_007948046.1.48129 XP_007975917.1.81039 XP_007975919.1.81039 XP_008145323.1.99482 XP_008564553.1.73410 XP_008702215.1.72690 XP_008848631.1.79516 XP_010353609.1.97406 XP_010371142.1.97406 XP_010604252.1.5607 XP_010829228.1.44457 XP_010955198.1.22495 XP_010974196.1.51371 XP_011366256.1.92234 XP_011752252.1.29376 XP_011853892.1.47321 XP_011853902.1.47321 XP_011979410.1.54773 XP_012317949.1.9421 XP_012383810.1.11602 XP_012503973.1.63892 XP_012887361.1.60039 XP_015002114.1.72884 XP_015002124.1.72884 XP_015337590.1.40921 XP_015360600.1.40921 XP_016011095.1.101085 XP_016073671.1.3490 XP_017354714.1.71028 XP_018892100.1.27298 XP_019586089.1.88060 XP_019812501.1.53367 XP_020018641.1.5219 XP_021545783.1.83697 ENSNLEP00000002823 ENSP00000355051 ENSP00000355051 ENSP00000433883 gi|5032155|ref|NP_005636.1| ENSMUSP00000121346 ENSPVAP00000008394 ENSCJAP00000004923 ENSPVAP00000008394 ENSDORP00000003989 ENSDORP00000003989 ENSBTAP00000042334 ENSPCAP00000005317 ENSLAFP00000009547 ENSSTOP00000009996 ENSMPUP00000002756 ENSP00000355051 ENSP00000433883 ENSCJAP00000004923 ENSOARP00000020446 ENSSTOP00000009996 ENSAMEP00000004786 10090.ENSMUSP00000121346 10116.ENSRNOP00000027530 9598.ENSPTRP00000038856 9606.ENSP00000355051 9913.ENSBTAP00000042334 9986.ENSOCUP00000020136 ENSPTRP00000038856 ENSMPUP00000002756 ENSBTAP00000042334 ENSPTRP00000038856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]