SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000039845 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000039845
Domain Number 1 Region: 3-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-86
Family Protein kinases, catalytic subunit 0.00000000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000039845   Gene: ENSPTRG00000005147   Transcript: ENSPTRT00000009467
Sequence length 303
Comment pep:known chromosome:CHIMP2.1.4:12:31595117:31599275:1 gene:ENSPTRG00000005147 transcript:ENSPTRT00000009467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
Download sequence
Identical sequences A0A024RBB6 G3QGD2 H2QZZ4 P11802
gi|4502735|ref|NP_000066.1| HR3131 ENSP00000257904 ENSP00000316889 NP_000066.1.87134 NP_000066.1.92137 XP_003824888.1.60992 XP_004053506.1.27298 XP_509173.2.37143 ENSP00000257904 ENSGGOP00000001387 9598.ENSPTRP00000039845 9606.ENSP00000257904 ENSPTRP00000039845 ENSPTRP00000039845 ENSGGOP00000001387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]