SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042286 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042286
Domain Number 1 Region: 12-210
Classification Level Classification E-value
Superfamily ITPase-like 1.44e-55
Family Maf-like 0.0000133
Further Details:      
 
Domain Number 2 Region: 287-352
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000286
Family LexA repressor, N-terminal DNA-binding domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042286   Gene: ENSPTRG00000021620   Transcript: ENSPTRT00000046289
Sequence length 353
Comment pep:known chromosome:CHIMP2.1.4:X:1510123:1542378:-1 gene:ENSPTRG00000021620 transcript:ENSPTRT00000046289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLCPVIGKLLHKRVVLASASPRRQEILSNAGLRFEVVPSKFKEKLDKASFATPYGYAME
TAKQKALEVANRMHQKDLRAPDVVIGADTIVTVGGLILEKPVDKQDAYRMLSRLSGREHS
VFTGVAIVHCSSKDHQLHTRVSEFYEETKVKFSELSEELLWEYVHSGEPMDKAGGYGIQA
LGGMLVESVHGDFLNVVGFPLNHFCKQLVKLYYPPRPEDLRRRVKHDSIPAADTFEDLSD
VEGGGPEPAQRDAGSRDEKAEAGEAGQAAAQAECHRTQETLPLFPTRLLELIEGFMLSKA
LFTACKLKVFDLLKDEAPQKAMDIASKVDASAYGTERLLDICAAMGLLEKTEQ
Download sequence
Identical sequences ENSPTRP00000042286 ENSPTRP00000042286 9598.ENSPTRP00000042286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]