SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043458 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043458
Domain Number 1 Region: 31-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.49e-92
Family Carbonic anhydrase 0.0000000000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043458   Gene: ENSPTRG00000023668   Transcript: ENSPTRT00000045069
Sequence length 354
Comment pep:known chromosome:CHIMP2.1.4:15:60722380:60781869:-1 gene:ENSPTRG00000023668 transcript:ENSPTRT00000045069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFIPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Download sequence
Identical sequences A0A2I3RZF9 G3QI60
ENSPTRP00000043458 XP_001173904.1.37143 XP_003827988.1.60992 XP_004056355.1.27298 ENSGGOP00000002062 9598.ENSPTRP00000043458 ENSGGOP00000002062 ENSPTRP00000043458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]