SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043548 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043548
Domain Number 1 Region: 349-522,556-720
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.11e-85
Family YicI catalytic domain-like 0.0007
Further Details:      
 
Domain Number 2 Region: 104-347
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.65e-41
Family YicI N-terminal domain-like 0.006
Further Details:      
 
Domain Number 3 Region: 723-819
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000288
Family Putative glucosidase YicI, domain 3 0.0073
Further Details:      
 
Domain Number 4 Region: 78-132
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000785
Family Trefoil 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043548   Gene: ENSPTRG00000009736   Transcript: ENSPTRT00000043482
Sequence length 952
Comment pep:known chromosome:CHIMP2.1.4:17:79283208:79301445:1 gene:ENSPTRG00000009736 transcript:ENSPTRT00000043482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVRHPPCSRRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSSVLEETHPAHQQGA
SRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLRGA
QMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLH
FTIKDPANRRYEVPLETPRVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHHGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGSTAFPDFTNPTTLAWWEDMVAEFHDQVPFDGMWLDMNEPSNFIRGSEDGCPNNELEN
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNGLLNLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPI
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP
MALAVALTTGGEARGELFWDDGESLEVLERGAHTQVIFLARNNTIVNELVRVTSEGAGLQ
LQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDIRVSLLMGEQFLVSWS
Download sequence
Identical sequences K7DLI9
ENSPTRP00000043548 ENSPTRP00000043548 9598.ENSPTRP00000043548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]