SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043649 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043649
Domain Number 1 Region: 997-1282
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-67
Family Protein kinases, catalytic subunit 0.0000369
Further Details:      
 
Domain Number 2 Region: 132-231
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000852
Family N-terminal PAS domain of Pas kinase 0.0000053
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000043649
Domain Number - Region: 244-313
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00262
Family Heme-binding PAS domain 0.014
Further Details:      
 
Domain Number - Region: 347-389
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00419
Family Heme-binding PAS domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043649   Gene: ENSPTRG00000013117   Transcript: ENSPTRT00000046535
Sequence length 1323
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:246431443:246481704:-1 gene:ENSPTRG00000013117 transcript:ENSPTRT00000046535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQS
RTALSEDRWSSYCLSSLAAQNICTSKLHCPAAPEHTDPSEPRGSVSCCSLLRGLSSGWSS
PLLPAPVCNPNKAIFTVDAKTTEILVTNDKACRLLGYSSQDLIGQKLTQFFLRSDSDVVE
ALSEEHMEADGHAAVVFGTVVDIISRSGEKIPVSVWMKRMRQEHRLCCVVVLEPVERVST
WVAFQSDGTVTSCDSLFAHLHGYVSGEDVAGQHITDLIPSVQLPPSGQHIPKNLKIQRSV
GRARDGTTFPLSLKLKSQPSSEEATTGEAAPVRGYRASVWVFCTISGLITLLPDGTIHGI
NHSFALTLFGYGKTELLGKNITFLIPGFYSYMDLAYNSSLQLPDLASCLDVGDESGCGER
TLDPWQGQDPAEGGQDPRINVVLAGGHVVPRDETRKLMESQDIFTGTQTELIAGGQLLSC
LSPQPAPGVDSVPEGSLPVHGEQALPKDQQITALGREEPVAIESPRQDLLGESRSEPVDV
KPFASCEDSEAPVPAEDGGSDAGMCGLCQKAQLERMGVSGPSGSDLWAGAAVAEPQAKGQ
LAGGSLLMHCPCYGSEWGLWWRSQDLAPSPSGMAGLSFGTPTLDEPWLGVKNDREELQTC
LIKEQLSQLSLAGALDVPHAELVPTECPAVTAPVSSCDLGGRDLCGGCTGSSSACYALAA
DLPGGLEAVEAQEVDVNSFSWNFKELFFSDQTDQTSSNCSCATSELRETPSSLAAGSDPD
VGSLQEQGSCVLDDRELLLLTGTCVDLGQGRRFRESCVGHDPTELLEVCLVSSEHYAASD
RESPGRVPSTLDAGPEDTCPSAEEPRLNVQVTSTPVIVMRGAAGLQREIQEGTYSGSCYH
RDGLRLSIQFEVRRVELQGPTPLFCCWLVKDLLHSQRDSAARTRLFLASLPGSTHSTAAE
LTGPSLVEVLRARPWFEEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKE
KNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDVFENQGFFQLV
MEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDF
TIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEE
NPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPEKRTTLEKLVTDPWVTQPVNLADY
TWEEVCRVNKPESGVLSTASLEMGNRSLSDVAQAQELCGGPVPGEAPNGQGCLHPGDPRL
LTS
Download sequence
Identical sequences ENSPTRP00000043649 ENSPTRP00000043649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]