SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043790 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043790
Domain Number 1 Region: 534-1006
Classification Level Classification E-value
Superfamily Ras GEF 4.97e-136
Family Ras GEF 0.000000000000379
Further Details:      
 
Domain Number 2 Region: 7-177
Classification Level Classification E-value
Superfamily Histone-fold 5.59e-51
Family TBP-associated factors, TAFs 0.000000271
Further Details:      
 
Domain Number 3 Region: 207-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-40
Family DBL homology domain (DH-domain) 0.000000183
Further Details:      
 
Domain Number 4 Region: 407-541
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-25
Family Pleckstrin-homology domain (PH domain) 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043790   Gene: ENSPTRG00000006328   Transcript: ENSPTRT00000043330
Sequence length 1301
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:49043356:49157214:-1 gene:ENSPTRG00000006328 transcript:ENSPTRT00000043330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
EKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPEFHEHFNKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGEREYVARRCNEFIMHVPLTRI
GAMHERHIFLFDGLMISCKPNHGQTRLPGYSSAEYRLKEKFVMRKIQICDKEDTCEYKHA
FELVSKDENSIIFAAKSAEEKNNWMAALISLHYRSTLDRMLDSVLLKEENEQPLRLPSPE
VYRFVVKDSEENIVFEDNLQSRSGIPIIKGGTVVKLIERLTYHMYADPNFVRTFLTTYRS
FCKPQELLSLLIERFEIPEPEPTDADKLAIEKGEQPISADLKRFRKEYVQPVQLRILNVF
RHWVEHHFYDFERDLELLERLESFISSVRGKAMKKWVESIAKIIRRKKQAQANGISHNIT
FESPPPPIEWHISKPGQFETFDLMTLHPIEIARQLTLLESDLYRKVQPSELVGSVWTKED
KEINSPNLLKMIRHTTNLTLWFEKCIVEAENFEERVAVLSRIIEILQVFQDLNNFNGVLE
IVSAVNSVSVYRLDHTFEALQERKRKILDEAVELSQDHFKKYLVKLKSINPPCVPFFGIY
LTNILKTEEGNNDFLKKKGKDLINFSKRRKVAEITGEIQQYQNQPYCLRIEPDMRRFFEN
LNPMGSASEKEFTDYLFNKSLEIEPRNCKQPPRFPRKSTFSLKSPGIRPNTGRHGSTSGT
LRGHPTPLEREPCKISFSRIAETELESTVSAPTSPNTPSTPPVSASSDLSVFLDVDLNSS
CGSNSIFAPVLLPHSKSFFSSCGSLHKLSEEPLIPPPLPPRKKFDHDASNSKGNMKSDDD
PPAIPPRQPPPPKVKPRVPVPTGAFDGPLHSPPPPPPRDPLPDTPPPVPLRPPEHFINCP
FNLQPPPLGHLHRDSDWLRDISTCPNSPSTPPSTPSPRVPRRCYVLSSSQNNLAHPPAPP
VPPRQNSSPHLPKLPPKTYKRELSHPPLYRLPLLENAETPQ
Download sequence
Identical sequences ENSPTRP00000043790 ENSPTRP00000043790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]