SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044129 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044129
Domain Number 1 Region: 101-502
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.29e-53
Family Glycerol-3-phosphate transporter 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000044129
Domain Number - Region: 40-73
Classification Level Classification E-value
Superfamily Kringle-like 0.0534
Family Kringle modules 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044129   Gene: ENSPTRG00000003796   Transcript: ENSPTRT00000042538
Sequence length 536
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:60919073:60941980:-1 gene:ENSPTRG00000003796 transcript:ENSPTRT00000042538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFSEILDRVGSMGRFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPW
VLPMGPNGKPERCLRFVHPPNASLPNDTQRATEPCLDGWVYNSTKDSIVTEWDLVCNSNK
LKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFR
FLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQL
TVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAAFNGKKEEGERLSLEELKLN
LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQI
IFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGI
TALLGGSAALFLPETLNQPLPETIEDLENKKPKQEPEEKASQRIPLQPHGPGLGSS
Download sequence
Identical sequences ENSPTRP00000044129 ENSPTRP00000044129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]