SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045364 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045364
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Histone-fold 4.19e-48
Family Nucleosome core histones 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045364   Gene: ENSPTRG00000029809   Transcript: ENSPTRT00000047489
Sequence length 128
Comment pep:novel chromosome:CHIMP2.1.4:6:27406993:27407449:1 gene:ENSPTRG00000029809 transcript:ENSPTRT00000047489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAK
Download sequence
Identical sequences A0A091DRN1 A0A096NEG1 A0A1D5QRS2 A0A1U7UX04 A0A286Y1W6 A0A287B0L6 A0A2J8SK36 A0A2K5E3K9 A0A2K5HK74 A0A2K5KUD3 A0A2K5UF51 A0A2K5XE21 A0A2K6ASW3 A0A2K6ER91 A0A2K6V938 A3KPC7 D2HWJ9 F6W1T4 G1QGA6 G3S4D2 G3SW65 G5BSF0 H0XF90 H2R3E3 I3M9B7 J9P2B7 L8I5K2 Q96KK5
ENSLAFP00000004533 ENSGGOP00000022934 ENSP00000366679 ENSMLUP00000022739 ENSP00000366679 ENSECAP00000001979 ENSETEP00000009410 ENSPTRP00000045364 ENSMMUP00000012598 ENSLAFP00000004533 NP_542163.1.87134 NP_542163.1.92137 XP_001093153.1.72884 XP_001494450.2.31192 XP_001928592.1.46622 XP_002721659.1.1745 XP_002721668.1.1745 XP_002816599.1.23681 XP_002927133.1.58354 XP_002927137.1.58354 XP_003422327.1.64505 XP_003463255.1.53824 XP_003463264.1.53824 XP_003801903.1.62490 XP_003810988.1.60992 XP_003944860.1.74449 XP_004019083.1.66739 XP_004019107.1.66739 XP_004043491.1.27298 XP_004286157.1.21590 XP_004317753.1.83887 XP_004387125.1.4749 XP_004390962.1.4749 XP_004596562.1.84141 XP_004628474.1.9945 XP_004628475.1.9945 XP_004670880.1.11716 XP_004847882.1.39548 XP_005553843.1.63531 XP_005603689.1.31192 XP_005696784.1.57651 XP_005902576.1.15283 XP_005982794.1.78601 XP_006048063.1.26621 XP_006903432.1.29581 XP_007105888.1.24612 XP_007449306.1.90284 XP_007955076.1.48129 XP_007971611.1.81039 XP_008070426.1.4292 XP_008539710.1.77740 XP_010621024.1.5607 XP_010816805.1.76553 XP_010823702.1.59421 XP_010830583.1.44457 XP_010972456.1.22495 XP_011756554.1.29376 XP_011800337.1.43180 XP_011846601.1.47321 XP_011931504.1.92194 XP_012014267.1.54773 XP_012494068.1.63892 XP_012597452.1.48125 XP_012597453.1.48125 XP_013219117.1.77405 XP_013965995.1.84170 XP_014303409.1.53796 XP_014684669.1.49734 XP_014694470.1.49734 XP_015989046.1.101085 XP_015989060.1.101085 XP_016075779.1.3490 XP_017894034.1.57651 XP_019664829.1.58354 XP_019840856.1.53367 XP_020758604.1.74333 XP_020760091.1.74333 XP_020955499.1.46622 XP_021522429.1.9421 XP_527273.1.37143 ENSTTRP00000012760 ENSTTRP00000012760 HGL_H00000366679 gi|18105045|ref|NP_542163.1| ENSETEP00000009410 ENSCPOP00000020378 ENSCPOP00000020552 ENSECAP00000001979 10141.ENSCPOP00000020378 10141.ENSCPOP00000020552 9361.ENSDNOP00000015767 9544.ENSMMUP00000012598 9598.ENSPTRP00000045364 9606.ENSP00000366679 9796.ENSECAP00000001979 ENSAMEP00000019588 ENSAMEP00000019616 ENSDNOP00000015767 ENSMICP00000004982 ENSMICP00000007690 ENSSTOP00000006455 ENSSARP00000001383 ENSMMUP00000012598 ENSDORP00000004184 ENSDORP00000008211 ENSGGOP00000022934 ENSDORP00000004184 ENSDORP00000008211 ENSSTOP00000006455 ENSSARP00000001383 ENSTBEP00000008366 ENSTBEP00000010926 ENSTBEP00000011712 ENSP00000366679 ENSCAFP00000039694 ENSMLUP00000022739 ENSPANP00000011281 ENSPTRP00000045364 ENSOGAP00000014666 ENSTBEP00000008366 ENSTBEP00000010926 ENSTBEP00000011712 ENSOPRP00000001137 ENSOPRP00000003329 ENSMICP00000004982 ENSMICP00000007690 ENSCAFP00000039694 ENSOGAP00000014666 ENSCPOP00000020378 ENSCPOP00000020552 ENSAMEP00000019588 ENSAMEP00000019616 ENSOPRP00000001137 ENSOPRP00000003329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]