SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047355 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047355
Domain Number 1 Region: 13-78
Classification Level Classification E-value
Superfamily Histone-fold 2.99e-18
Family TBP-associated factors, TAFs 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047355   Gene: ENSPTRG00000022053   Transcript: ENSPTRT00000041060
Sequence length 251
Comment pep:known_by_projection chromosome:CHIMP2.1.4:X:78002134:78012378:-1 gene:ENSPTRG00000022053 transcript:ENSPTRT00000041060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSH
AKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRY
CLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTS
QRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKR
KHDDDDDNDIM
Download sequence
Identical sequences H2R4N5
ENSPTRP00000047355 9598.ENSPTRP00000047355 ENSPTRP00000047355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]