SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047488 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047488
Domain Number 1 Region: 50-296
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.4e-91
Family Carbonic anhydrase 0.0000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047488   Gene: ENSPTRG00000021692   Transcript: ENSPTRT00000055072
Sequence length 317
Comment pep:known chromosome:CHIMP2.1.4:X:15867409:15908541:1 gene:ENSPTRG00000021692 transcript:ENSPTRT00000055072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPG
GDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVI
GVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNVQAKPKPATSQATP
Download sequence
Identical sequences A0A024RBW9 H2R4T4 Q9Y2D0
NP_009151.1.87134 NP_009151.1.92137 XP_001139130.1.37143 XP_005274499.1.92137 XP_009437078.1.37143 gi|6005723|ref|NP_009151.1| ENSPTRP00000047488 ENSP00000314099 ENSP00000417021 ENSP00000417021 ENSP00000314099 ENSP00000417021 9598.ENSPTRP00000047488 9606.ENSP00000314099 ENSPTRP00000047488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]