SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047605 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047605
Domain Number 1 Region: 357-533,568-734
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.16e-82
Family YicI catalytic domain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 1225-1424,1469-1630
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.56e-77
Family YicI catalytic domain-like 0.00021
Further Details:      
 
Domain Number 3 Region: 2122-2321,2366-2527
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.75e-76
Family YicI catalytic domain-like 0.00022
Further Details:      
 
Domain Number 4 Region: 112-356
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.41e-48
Family YicI N-terminal domain-like 0.0092
Further Details:      
 
Domain Number 5 Region: 1875-2119
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.45e-46
Family YicI N-terminal domain-like 0.0061
Further Details:      
 
Domain Number 6 Region: 978-1222
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.13e-44
Family YicI N-terminal domain-like 0.0061
Further Details:      
 
Domain Number 7 Region: 1633-1713
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.63e-20
Family Putative glucosidase YicI, domain 3 0.0092
Further Details:      
 
Domain Number 8 Region: 2530-2610
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.63e-20
Family Putative glucosidase YicI, domain 3 0.0092
Further Details:      
 
Domain Number 9 Region: 737-817
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.73e-16
Family Putative glucosidase YicI, domain 3 0.017
Further Details:      
 
Domain Number 10 Region: 1846-1897
Classification Level Classification E-value
Superfamily Trefoil 0.000000000889
Family Trefoil 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047605   Gene: ENSPTRG00000019786   Transcript: ENSPTRT00000055168
Sequence length 2754
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:143459009:143568258:1 gene:ENSPTRG00000019786 transcript:ENSPTRT00000055168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKKLKKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTTGTP
DPGTTGTTHPRTTGPPDPGTTATTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWN
PQGAVSVPWCYYSKNHSYHMEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTS
NRFHFKLTDQTNNRFEVPHEHMQSFSGNAASSLTYQVEISRQPFSIKVTRRSNNRVLFDS
SIGPLLFADQFLQLSTRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLY
GAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVV
QEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDER
RDFTYDPVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNS
SDGVTPLIGEVWPGQSVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGS
VSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDVHNLYGYSMAVATAEAAKT
VFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICG
FALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLL
PYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAY
VPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGL
IIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNHLEVNISQSTYKDPNNLAFN
EIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRD
EEKIDCYPDENGASAENCTARGCIWEASNSSGVPFCYFVNDLYSVSDVQYNSHGATADIS
LKSSIYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNIPSMPSSTPEG
QLYDVLIKKNPSGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHR
SYRRDLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPL
PALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIA
SLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAI
SGNETQPYPAFTRGIEDDVFIKYPNDGDIVWGKVWPDFPNVVVNGSLDWDSQVELYRAYV
AFPDFFRNSTGKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDAS
LNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAVQEV
TGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFF
EDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDAAFVNISRTVLQTRYTLLPYLY
TLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRA
RWYDYYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSSRKNPLGLIIA
LDENKEAKGELFWDDGQTKDTVANKVYLLCEFSVTQNHLEVNISQSTYKDPNNLAFNEIK
ILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDINLFLGEAYTVEWSIKIRDEEK
IDCYPDENGASAENCTARGCIWEASNSSGVPFCYFVDDLYSVSDVQYNSHGATADISLKS
SVHASAFPSTPVNPLRLHVTYHKNEMLQFKIYDPNNNRYEVPVPLNIPSVPSSTPEGQLY
DVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLPSKYLYGFGETEHRSYR
RDLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPAL
TYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLY
DEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAISGN
ETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFP
DFFRNSTGKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDASLNH
PPYMPYLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTYEAVQEVTGQ
RGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFEDA
EYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLYTLM
HKAHTEGITVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWY
DYYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDE
GTAGGWLFWDDGQSIDTYGKGLYYLASFSASQNTMQSHIIFNNYITGTNPLKLGYIEIWG
VGSVPITSVSISVSGMVITPSFNNDPTTQVLSIDVTDRNISLHNFTSLTWIITL
Download sequence
Identical sequences ENSPTRP00000047605 ENSPTRP00000047605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]