SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047875 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047875
Domain Number 1 Region: 6-350
Classification Level Classification E-value
Superfamily ALDH-like 3.4e-107
Family ALDH-like 0.00000000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047875   Gene: ENSPTRG00000003974   Transcript: ENSPTRT00000045259
Sequence length 385
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:65624348:65629823:-1 gene:ENSPTRG00000003974 transcript:ENSPTRT00000045259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDEPRSTNLFMKLDSVFIRKEPFGLVFIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSE
ISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHELDYIFFTGSPRVGKIVMTAAT
KHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNTGQTCVAPDYVLCSPEMQERLL
PALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRTLLGCGRVAIGGQSNESDRYIAPTVL
VDVQETEPVMQEEIFGPILPIVNVQSVDEAIEFINRREKPLDLYAFSNSSQVVNQMLKRT
SSGSFGGNEGFTYISLPSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEI
RYPPYTDWNQQLLRWGMGSQSCSLL
Download sequence
Identical sequences H2R571
ENSPTRP00000047875 ENSPTRP00000047875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]