SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048600 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048600
Domain Number 1 Region: 239-339
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.88e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000613
Further Details:      
 
Domain Number 2 Region: 91-153
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000288
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.053
Further Details:      
 
Domain Number 3 Region: 12-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000602
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048600   Gene: ENSPTRG00000011180   Transcript: ENSPTRT00000020775
Sequence length 667
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:51216728:51253792:1 gene:ENSPTRG00000011180 transcript:ENSPTRT00000020775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWQDHRSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTIS
YLRMHRLCAAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLSQL
ELIGHSIFDFIHPCDQEELQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRGRTLNLK
AATWKVLNCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPLGRGAFL
SRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTG
QYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISRVEETGVVLSLEQTEQHSRR
PIQRGAPSQKDTPNPADSLDAPGPRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGPIL
DGASVAATPSTPLATRRPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDA
DALDLEMLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALEPSLLPR
WGSDPRLSCSSPSRGDPSASSPVAGARKRTLAQSSEDEDEGVELLGVRPPKRSPSPEHEN
FLLFPLSLSFLLTGGPAPGSLQDPSTPLLNLNEPLGLRPSLLSPYSDEDTTQPGGPFQPR
AGSAQAD
Download sequence
Identical sequences A0A2I3TC33
XP_001167523.1.37143 9598.ENSPTRP00000048600 ENSPTRP00000048600 ENSPTRP00000048600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]