SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049651 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000049651
Domain Number - Region: 62-94
Classification Level Classification E-value
Superfamily Histone-fold 0.0191
Family TBP-associated factors, TAFs 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049651   Gene: ENSPTRG00000029421   Transcript: ENSPTRT00000056850
Sequence length 103
Comment pep:novel chromosome:CHIMP2.1.4:6:127600117:127609044:1 gene:ENSPTRG00000029421 transcript:ENSPTRT00000056850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVRFHPFSGWEWGTGEVHL
NCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG
Download sequence
Identical sequences A0A2J8PTL1
ENSP00000357308 ENSPTRP00000049651 ENSPTRP00000049651 NP_001273453.1.87134 NP_001273453.1.92137 XP_008951208.1.60992 ENSP00000357308 ENSP00000357311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]