SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050478 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050478
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Histone-fold 3.22e-47
Family Nucleosome core histones 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050478   Gene: ENSPTRG00000029802   Transcript: ENSPTRT00000057585
Sequence length 82
Comment pep:novel chromosome:CHIMP2.1.4:6:28087150:28087398:1 gene:ENSPTRG00000029802 transcript:ENSPTRT00000057585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLP
GELAKHAVSEGTKAVTKYTSSK
Download sequence
Identical sequences ENSPTRP00000050478 9598.ENSPTRP00000050478 ENSPTRP00000050478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]