SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050479 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050479
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily Histone-fold 4.68e-59
Family Nucleosome core histones 0.00000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050479   Gene: ENSPTRG00000017849   Transcript: ENSPTRT00000057586
Sequence length 126
Comment pep:novel chromosome:CHIMP2.1.4:6:28079152:28079532:-1 gene:ENSPTRG00000017849 transcript:ENSPTRT00000057586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERLASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
Download sequence
Identical sequences H2R7J4
XP_001138116.1.37143 9598.ENSPTRP00000050479 ENSPTRP00000050479 ENSPTRP00000050479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]