SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050502 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050502
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily Histone-fold 1.19e-59
Family Nucleosome core histones 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050502   Gene: ENSPTRG00000029815   Transcript: ENSPTRT00000057606
Sequence length 126
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:26517969:26518393:1 gene:ENSPTRG00000029815 transcript:ENSPTRT00000057606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
Download sequence
Identical sequences A0A1U7UDT5 A0A2I2YHC9 A0A2I3GFP7 A0A2I3S3G2 A0A2K5BV29 A0A2K5RG83 A0A2K6EPT0 A0A2K6S9S6 F7H706 G1U155 G3STA3 H2PI63 Q93079
NP_003515.1.87134 NP_003515.1.92137 XP_002721656.1.1745 XP_002721658.1.1745 XP_002816575.1.23681 XP_003421149.1.64505 XP_004088814.1.23891 XP_004384080.1.4749 XP_004387128.1.4749 XP_004596563.1.84141 XP_005369986.1.66349 XP_006988923.1.50099 XP_006988927.1.50099 XP_008070429.1.4292 XP_008260690.1.1745 XP_008824867.1.79516 XP_008830080.1.79516 XP_008830088.1.79516 XP_010331013.1.74449 XP_010331015.1.74449 XP_012321290.1.9421 XP_012321311.1.9421 XP_012321313.1.9421 XP_012494076.1.63892 XP_012807239.1.11716 XP_014200730.1.60992 XP_016810518.1.37143 XP_016810519.1.37143 XP_017360679.1.71028 XP_017376849.1.71028 XP_018875516.1.27298 ENSTSYP00000011632 ENSTSYP00000012291 ENSSSCP00000001234 ENSCJAP00000020306 ENSCJAP00000034718 ENSNLEP00000022264 ENSSSCP00000001234 gi|4504269|ref|NP_003515.1| ENSP00000348706 ENSPCAP00000004942 ENSSARP00000005075 ENSSARP00000005075 ENSPCAP00000004942 ENSPTRP00000050502 ENSOCUP00000012424 ENSOCUP00000018894 ENSOCUP00000023088 ENSPPYP00000018251 ENSLAFP00000003262 ENSTSYP00000011632 ENSTSYP00000012291 ENSOCUP00000012424 ENSOCUP00000018894 ENSOCUP00000023088 ENSOPRP00000003320 ENSOPRP00000016352 ENSP00000479169 ENSPTRP00000050502 ENSP00000348706 ENSOPRP00000003320 ENSOPRP00000016352 ENSLAFP00000003262 9598.ENSPTRP00000050502 9600.ENSPPYP00000018251 9606.ENSP00000348706 9823.ENSSSCP00000001234 9986.ENSOCUP00000012424 9986.ENSOCUP00000018894 9986.ENSOCUP00000023088 ENSPPYP00000018251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]