SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050902 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050902
Domain Number 1 Region: 23-120
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-35
Family Chaperone J-domain 0.00019
Further Details:      
 
Domain Number 2 Region: 251-329
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.16e-19
Family HSP40/DnaJ peptide-binding domain 0.00083
Further Details:      
 
Domain Number 3 Region: 129-152,193-253
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000000262
Family HSP40/DnaJ peptide-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050902   Gene: ENSPTRG00000015713   Transcript: ENSPTRT00000029291
Sequence length 358
Comment pep:known chromosome:CHIMP2.1.4:3:190632274:190647742:1 gene:ENSPTRG00000015713 transcript:ENSPTRT00000029291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDD
PQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGT
PRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQL
GPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLR
FRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLW
KKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEVREGIKQLLKQGSVQKVYNGLQGY
Download sequence
Identical sequences H2R7V8
ENSPTRP00000050902 9598.ENSPTRP00000050902 ENSPTRP00000050902 XP_001153126.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]