SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051376 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051376
Domain Number 1 Region: 458-707
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.42e-58
Family Eukaryotic proteases 0.0000346
Further Details:      
 
Domain Number 2 Region: 155-238
Classification Level Classification E-value
Superfamily Kringle-like 7.73e-33
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 3 Region: 343-378,414-463
Classification Level Classification E-value
Superfamily Kringle-like 7.6e-17
Family Kringle modules 0.0011
Further Details:      
 
Domain Number 4 Region: 20-104
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.16e-16
Family Hairpin loop containing domain 0.017
Further Details:      
 
Domain Number 5 Region: 72-154
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000556
Family Kringle modules 0.0017
Further Details:      
 
Domain Number 6 Region: 248-334
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000004
Family Kringle modules 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051376   Gene: ENSPTRG00000014929   Transcript: ENSPTRT00000058389
Sequence length 709
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:50465654:50471145:-1 gene:ENSPTRG00000014929 transcript:ENSPTRT00000058389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLPLLLLLTQCLGAPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRC
GPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKGKWGYTPTLRNGLEEN
FCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCREAACVWCNGEEYRGAVDRTESGRECQRW
DLQHPHQHPFEPGKFLDQGLDDNYCRNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPR
QEATTVSCFRGKGEGYRGTANTTTAAYLASVGTRKSRISTDLRQKNTRASEVGGAGVGTC
CCGDLRENFCRNPDGSEAPWCFTLRPGMRVAFCYQIRRCTDDVRPQDCYHGAGEQYRGTV
SKTRKGVQCQRWSAETPHKPQALTLGRHALVSGTRAWKWLRLPCHXFAPASARVHXYLRX
ACTTGGDFLPDPDGDSHGPWCYTMDPRTPFDYCALRRCDQVQFEKCGKRVDRLDQRRSKL
RVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGTLF
QNPQHGEPGLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGTKC
EIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMCTEGLLAPVGACEGDYG
GPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSVFVDWIHKVMRLG
Download sequence
Identical sequences ENSPTRP00000051376 ENSPTRP00000051376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]