SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051511 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051511
Domain Number 1 Region: 112-251
Classification Level Classification E-value
Superfamily dUTPase-like 7.46e-50
Family dUTPase-like 0.000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051511   Gene: ENSPTRG00000007044   Transcript: ENSPTRT00000013003
Sequence length 252
Comment pep:known chromosome:CHIMP2.1.4:15:45512864:45524818:1 gene:ENSPTRG00000007044 transcript:ENSPTRT00000013003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLCPRPALCYHFLLSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQYGIPRPLSSA
GRLSQGCRGASTVGAAGWKGELPKAGGCPAPGPETPAISPSKRARPAEEGSMQLRFARLS
EHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKH
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQDLDDTE
RGSGGFGSTGKN
Download sequence
Identical sequences H2R8E7
ENSPTRP00000051511 9598.ENSPTRP00000051511 ENSPTRP00000051511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]