SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051820 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051820
Domain Number 1 Region: 4-126
Classification Level Classification E-value
Superfamily Histone-fold 1.65e-48
Family Nucleosome core histones 0.00000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051820   Gene: ENSPTRG00000030410   Transcript: ENSPTRT00000058775
Sequence length 130
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:128036812:128037204:-1 gene:ENSPTRG00000030410 transcript:ENSPTRT00000058775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TESHKPGKNK
Download sequence
Identical sequences A0A096MWB2 A0A0D9SA92 A0A1U7SXB2 A0A286XDK2 A0A2F0BAR1 A0A2K5C121 A0A2K5JLR6 A0A2K5KYQ6 A0A2K5PMU4 A0A2K5XRE1 A0A2K6ASG4 A0A2K6JZ90 A0A2K6NRI9 A0A2K6S8R5 F2Z5L6 F7CQ97 F7HSJ5 G1LU90 G3QKC9 G3SNM3 G5BH22 G7NTR7 H2N611 H2R8P5 I3MYV5 L8IKS0 M3XAG6 M3Z3Z2 Q8IUE6 S9WTT9 W5PV69
ENSSTOP00000017301 ENSTBEP00000009761 ENSTBEP00000009761 ENSSSCP00000007111 ENSPPYP00000001069 ENSTTRP00000004851 ENSMPUP00000018304 ENSVPAP00000007581 ENSCPOP00000021059 ENSGGOP00000002903 ENSLAFP00000001233 ENSSTOP00000017301 ENSECAP00000005811 ENSP00000332790 ENSP00000462774 ENSOARP00000014351 ENSAMEP00000010638 ENSMMUP00000003467 ENSTTRP00000004851 gi|28195394|ref|NP_778235.1| ENSFCAP00000023620 ENSECAP00000005811 ENSP00000332790 ENSP00000462774 ENSSSCP00000007111 10141.ENSCPOP00000021059 9361.ENSDNOP00000001887 9544.ENSMMUP00000003467 9598.ENSPTRP00000051820 9600.ENSPPYP00000001069 9606.ENSP00000332790 9796.ENSECAP00000005811 9823.ENSSSCP00000007111 ENSDNOP00000001887 ENSPTRP00000051820 ENSPPYP00000001069 NP_778235.1.87134 NP_778235.1.92137 XP_001096734.1.72884 XP_001166488.1.37143 XP_002686098.1.76553 XP_002810346.1.23681 XP_003409558.1.64505 XP_003478920.1.53824 XP_003639665.1.84170 XP_003817373.1.60992 XP_003942031.1.74449 XP_003990606.1.62641 XP_004026603.1.27298 XP_004285174.1.21590 XP_004315558.1.83887 XP_004404235.1.74151 XP_004435995.1.5094 XP_004461696.1.11602 XP_004776887.1.14098 XP_004853992.1.39548 XP_005378772.1.28644 XP_005542100.1.63531 XP_005677762.1.57651 XP_005894933.1.15283 XP_005970804.1.78601 XP_006049267.1.26621 XP_006168562.1.99106 XP_006186638.1.101512 XP_006216978.1.17985 XP_006902293.1.29581 XP_007088097.1.5354 XP_007114486.1.24612 XP_007463541.1.90284 XP_007949161.1.48129 XP_008017402.1.81039 XP_008052489.1.4292 XP_008513091.1.77740 XP_008693966.1.72690 XP_010385599.1.97406 XP_010837038.1.44457 XP_010956823.1.22495 XP_010994991.1.51371 XP_011767455.1.29376 XP_011793142.1.43180 XP_011829037.1.47321 XP_011924835.1.92194 XP_012016759.1.54773 XP_012035685.1.66739 XP_012317965.1.9421 XP_014595410.1.31192 XP_014720926.1.49734 XP_017401899.1.71028 XP_017733346.1.44346 XP_019288445.1.44245 XP_019288446.1.44245 XP_019595436.1.88060 XP_020008978.1.5219 XP_020755540.1.74333 XP_020945584.1.46622 XP_021586083.1.77405 XP_871733.2.59421 ENSPANP00000011107 ENSMMUP00000003467 ENSLAFP00000001233 ENSVPAP00000007581 ENSAMEP00000010638 ENSP00000332790 ENSDNOP00000024426 ENSMPUP00000018304 HGL_H00000332790 ENSGGOP00000002903 ENSPTRP00000051820 ENSCPOP00000021059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]