SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000051823 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000051823
Domain Number 1 Region: 8-125
Classification Level Classification E-value
Superfamily Histone-fold 7.26e-59
Family Nucleosome core histones 0.00000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000051823   Gene: ENSPTRG00000030417   Transcript: ENSPTRT00000058779
Sequence length 166
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:127963572:127981957:-1 gene:ENSPTRG00000030417 transcript:ENSPTRT00000058779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSNPGNLSPTKPGGSEDRHPPPSQLSAIPPFCLVLRAGIAGQV
Download sequence
Identical sequences ENSPTRP00000051823 ENSPTRP00000060958 XP_003808844.1.60992 XP_016781574.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]