SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052282 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052282
Domain Number 1 Region: 79-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000877
Family LDL receptor-like module 0.0038
Further Details:      
 
Domain Number 2 Region: 162-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000772
Family LDL receptor-like module 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000052282
Domain Number - Region: 127-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000131
Family LDL receptor-like module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052282   Gene: ENSPTRG00000030591   Transcript: ENSPTRT00000059171
Sequence length 205
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:54486784:54496035:-1 gene:ENSPTRG00000030591 transcript:ENSPTRT00000059171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKVFPQGENGYTAAEPKAHPGGEAGGGHLCCSRRGACLSASLLLLLATVAALIALVTIL
GLPSHTPGAQACITLTNRTGFLCHDQRSCIPASGVCDGIRTCTHGEDEDESLCRDVPQSL
PHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSPVTVCPPCGPGWWRCPSTFFKYCDC
IPRHLCRDHVQHCSDWSDEYACPGP
Download sequence
Identical sequences ENSPTRP00000052282 ENSPTRP00000052282 9598.ENSPTRP00000052282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]