SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052493 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052493
Domain Number 1 Region: 234-700
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.18e-48
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 
Domain Number 2 Region: 645-831
Classification Level Classification E-value
Superfamily TolB, C-terminal domain 1.23e-17
Family TolB, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052493   Gene: ENSPTRG00000006714   Transcript: ENSPTRT00000012363
Sequence length 834
Comment pep:known chromosome:CHIMP2.1.4:14:99467994:99616640:1 gene:ENSPTRG00000006714 transcript:ENSPTRT00000012363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGFSSYSSLYDTSSLLQFCNDDSASAASSMEVTDRIASLEQRVQMQEDDIQLLKSALA
DVVRRLNITEEQQAVLNRKGPTKARPLMQTLPLRTTVNNGTVLPKKPTGSLPSPSGVRKE
TAVPATKRLNRSVSLLNACKLNRSTPSNIKRTSSSERVSPGGRRESNGDSRGNRNRTGST
SSSSSGKKNSESKPKEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRL
KLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHP
DRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTN
LCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLE
GSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEG
GIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPIRTVAEGKGDVILIGT
TRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDK
IIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFL
AIGSHDNCIYIYGVSENGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVP
SACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFG
KVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI
Download sequence
Identical sequences H2R968
ENSPTRP00000052493 XP_001157076.2.37143 ENSPTRP00000052493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]