SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052956 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052956
Domain Number 1 Region: 4-433
Classification Level Classification E-value
Superfamily ALDH-like 6.68e-133
Family ALDH-like 0.00000000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052956   Gene: ENSPTRG00000008874   Transcript: ENSPTRT00000016363
Sequence length 453
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:36246478:36258447:1 gene:ENSPTRG00000008874 transcript:ENSPTRT00000016363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKISEAVKRARAAFSSGRTRLLQFRIQQLEALRRLIQEQEQELVGALTAYMHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNAVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREK
PLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH
Download sequence
Identical sequences ENSPTRP00000052956 ENSPTRP00000052956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]