SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054006 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054006
Domain Number 1 Region: 33-426
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.29e-70
Family L-arabinose binding protein-like 0.0011
Further Details:      
 
Domain Number 2 Region: 446-560,679-819
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.88e-66
Family Phosphate binding protein-like 0.00000000105
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000054006
Domain Number - Region: 529-674
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000497
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054006   Gene: ENSPTRG00000013825   Transcript: ENSPTRT00000025803
Sequence length 918
Comment pep:known chromosome:CHIMP2.1.4:21:15738201:16097984:-1 gene:ENSPTRG00000013825 transcript:ENSPTRT00000025803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHGTLLAQPGLWTRDTSWALLYFLCYILPQTAPQVLRVGGIFETVENEPVNVEELAFKF
AVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQ
SICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISRAILDLVLYYNWKTVTVVYEDS
TGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEIL
KQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRF
MNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGI
WNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCL
DLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREK
VIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFT
PYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTL
IIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKM
WAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFI
VLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFCFFYGLQCKQTHPTNSTSGTTLSTDLECG
KLIREERGIRKQSSVHTV
Download sequence
Identical sequences ENSPTRP00000058547 ENSPTRP00000054006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]