SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054650 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054650
Domain Number 1 Region: 28-124
Classification Level Classification E-value
Superfamily Histone-fold 6.11e-91
Family Nucleosome core histones 0.00000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054650   Gene: ENSPTRG00000030413   Transcript: ENSPTRT00000058777
Sequence length 126
Comment pep:novel chromosome:CHIMP2.1.4:6:27400466:27406759:-1 gene:ENSPTRG00000030413 transcript:ENSPTRT00000058777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
Download sequence
Identical sequences A0A024RCL8 A0A091DU07 A0A0D9SCK7 A0A1U7UFG0 A0A286XJQ3 A0A2I2ZZ53 A0A2I3G1L3 A0A2K5DCY1 A0A2K6EL19 A0A2K6S5Q5 F2Z4F9 F6TWM4 F7FWZ8 G3IB92 G3V9C7 G5BSE9 H0XT51 H2PI79 H2RAX0 I0FVV7 I3MZB0 J9P6S8 L5JVZ3 L8YET9 M3WVP6 O60814 S9WX75
ENSOGAP00000019293 ENSNLEP00000005345 ENSTBEP00000010851 ENSDNOP00000031912 ENSRNOP00000042325 ENSECAP00000001849 ENSTSYP00000001037 ENSP00000349430 ENSPTRP00000054650 ENSCPOP00000006353 ENSOGAP00000019293 ENSPVAP00000000717 ENSPVAP00000005969 ENSPTRP00000054650 ENSCHOP00000005405 2cv5D HGL_H00000349430-2 ENSCJAP00000020596 ENSBTAP00000052749 ENSSSCP00000001244 ENSPANP00000000443 ENSPCAP00000008497 ENSP00000349430 ENSP00000380100 ENSTBEP00000010851 ENSBTAP00000052749 ENSCAFP00000041361 ENSP00000349430 ENSCHOP00000005405 ENSSTOP00000016809 ENSSTOP00000017456 ENSRNOP00000042325 ENSPPYP00000018270 ENSNLEP00000005345 ENSPPYP00000018270 ENSTSYP00000001037 ENSDNOP00000016783 ENSDNOP00000017170 ENSSSCP00000001244 NP_001102870.1.100692 NP_001102870.1.4139 NP_001247459.1.72884 NP_001299582.1.87134 NP_001299582.1.92137 NP_542160.1.87134 NP_542160.1.92137 XP_001505089.1.31192 XP_002816597.1.23681 XP_003271988.1.23891 XP_003422328.1.64505 XP_003463266.1.53824 XP_003512226.1.69978 XP_003512229.1.69978 XP_003801911.1.62490 XP_003810984.1.60992 XP_003944862.1.74449 XP_003985735.1.62641 XP_004019108.1.66739 XP_004390963.1.4749 XP_004406581.1.74151 XP_004463569.1.11602 XP_004477773.1.11602 XP_004481907.1.11602 XP_005337126.1.77405 XP_005553863.1.63531 XP_005902575.1.15283 XP_005982793.1.78601 XP_006048064.1.26621 XP_006162727.1.99106 XP_006182217.1.101512 XP_006735972.1.47382 XP_006735980.1.47382 XP_006735983.1.47382 XP_006902697.1.29581 XP_006903433.1.29581 XP_006903436.1.29581 XP_006923523.1.64745 XP_006988915.1.50099 XP_007074526.1.5354 XP_007634673.1.28591 XP_007955083.1.48129 XP_007971618.1.81039 XP_008071004.1.4292 XP_008566072.1.73410 XP_008691202.1.72690 XP_008992054.1.60252 XP_008992055.1.60252 XP_010372727.1.97406 XP_010372732.1.97406 XP_010372749.1.97406 XP_010621025.1.5607 XP_010830584.1.44457 XP_010972474.1.22495 XP_010978496.1.51371 XP_011385935.1.92234 XP_011756556.1.29376 XP_011800339.1.43180 XP_011846600.1.47321 XP_011931506.1.92194 XP_012020739.1.54773 XP_012321308.1.9421 XP_012376420.1.11602 XP_012422572.1.74151 XP_012494070.1.63892 XP_012494071.1.63892 XP_012494072.1.63892 XP_012597454.1.48125 XP_012597458.1.48125 XP_012597459.1.48125 XP_012597551.1.48125 XP_012928663.1.39548 XP_013219121.1.77405 XP_014694462.1.49734 XP_014941938.1.86478 XP_015349641.1.40921 XP_015349647.1.40921 XP_015453812.1.64745 XP_015989109.1.101085 XP_015989148.1.101085 XP_015989229.1.101085 XP_015989247.1.101085 XP_016075783.1.3490 XP_016075784.1.3490 XP_017520897.1.32401 XP_017715474.1.44346 XP_017715475.1.44346 XP_017894036.1.57651 XP_018884897.1.27298 XP_019280738.1.44245 XP_019280741.1.44245 XP_019569749.1.88060 XP_019687258.1.62641 XP_019687259.1.62641 XP_019840863.1.53367 XP_020742256.1.74333 XP_020955504.1.46622 XP_021522430.1.9421 XP_021552578.1.83697 XP_021552862.1.83697 XP_518295.2.37143 XP_545412.3.84170 XP_859540.1.84170 ENSSTOP00000016809 ENSSTOP00000017456 ENSCJAP00000020596 gi|18105048|ref|NP_542160.1| ENSCAFP00000041361 ENSPVAP00000000717 ENSPVAP00000005969 ENSFCAP00000018433 ENSFCAP00000020576 ENSCPOP00000006353 ENSECAP00000001849 2cv5_D 2cv5_H ENSPCAP00000008497 10116.ENSRNOP00000042325 10141.ENSCPOP00000006353 9361.ENSDNOP00000016783 9361.ENSDNOP00000017170 9598.ENSPTRP00000054650 9600.ENSPPYP00000018270 9606.ENSP00000349430 9796.ENSECAP00000001849 9823.ENSSSCP00000001244 9913.ENSBTAP00000052749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]