SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054759 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054759
Domain Number 1 Region: 422-478
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.88e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 2 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000523
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054759   Gene: ENSPTRG00000039894   Transcript: ENSPTRT00000062205
Sequence length 478
Comment pep:known chromosome:CHIMP2.1.4:2A:49390505:49453114:1 gene:ENSPTRG00000039894 transcript:ENSPTRT00000062205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACLNPVPKLYRSVIEDVIEGVRNLFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNS
IQSPLFTLQLPHSLHQTLQSSTASLVIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVP
AGVTLQTVSGHLYKVNVPIMVTETSGRAGILQHPIQQVFQQLGQPSVIQTSVPQLNPWSL
QATTEKSQRIETVLQQPAILPSGPVDRKHLENATSDILVSPGNEHKIVPEALLCHQESSH
YISLPGVVFSPQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHVTDIQLHILK
NRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDLSIRVTDDDTGEIIQVDGSGDTSSNEE
IGSTRDADENEFLGNIDRGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD
DVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRDYVFAKAIGDAEW
Download sequence
Identical sequences H2RAZ7
ENSPTRP00000054759 ENSPTRP00000054759 NP_001191755.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]