SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000055668 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000055668
Domain Number 1 Region: 168-465
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.53e-42
Family NadC C-terminal domain-like 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000055668
Domain Number - Region: 68-99
Classification Level Classification E-value
Superfamily DUSP-like 0.0759
Family DUSP, domain in ubiquitin-specific proteases 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000055668   Gene: ENSPTRG00000019571   Transcript: ENSPTRT00000064122
Sequence length 472
Comment pep:known chromosome:CHIMP2.1.4:7:107733916:107766885:-1 gene:ENSPTRG00000019571 transcript:ENSPTRT00000064122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEK
IQEAKDIYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDP
ECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVS
SQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEK
DAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLD
TVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIENIA
FGSGGGLLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGN
FVTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAHH
Download sequence
Identical sequences ENSPTRP00000055668 ENSPTRP00000055668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]