SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057637 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000057637
Domain Number - Region: 10-74
Classification Level Classification E-value
Superfamily Histone-fold 0.00133
Family Archaeal histone 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057637   Gene: ENSPTRG00000009783   Transcript: ENSPTRT00000066063
Sequence length 81
Comment pep:novel chromosome:CHIMP2.1.4:17:81500116:81503842:-1 gene:ENSPTRG00000009783 transcript:ENSPTRT00000066063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLVVELLKVFVVEAAVRGVRQAQAE
DALRVDVDQLEKVLPQLLLDF
Download sequence
Identical sequences A0A2J8JFR3
9598.ENSPTRP00000057637 ENSPTRP00000057637 ENSPTRP00000057637 XP_001167110.1.37143 XP_003831140.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]