SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057814 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057814
Domain Number 1 Region: 5-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.65e-64
Family D-ribulose-5-phosphate 3-epimerase 0.00000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057814   Gene: ENSPTRG00000002906   Transcript: ENSPTRT00000005534
Sequence length 228
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:102483373:102484577:1 gene:ENSPTRG00000002906 transcript:ENSPTRT00000005534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECLQMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSKPEQWVKPMAVAEANQYTFHLEATENPGTLIKDIRENGMKVGLAIK
PGTSVEYLAPWANQIDMALVMTVEPGFGEQKFMEDMMPKVHWLRTQFPSLDIEGDGGVGS
DTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences Q2QD11
ENSPTRP00000057814 9598.ENSPTRP00000057814 ENSPTRP00000057814 XP_508010.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]