SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059890 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059890
Domain Number 1 Region: 583-676
Classification Level Classification E-value
Superfamily TAFH domain-like 7.98e-36
Family TAFH domain-like 0.00000269
Further Details:      
 
Domain Number 2 Region: 870-917
Classification Level Classification E-value
Superfamily Histone-fold 4.6e-17
Family TBP-associated factors, TAFs 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059890   Gene: ENSPTRG00000013695   Transcript: ENSPTRT00000075709
Sequence length 1083
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:59239356:59330584:-1 gene:ENSPTRG00000013695 transcript:ENSPTRT00000075709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGN
HVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPRRPGPPSPRRPLVPAGPA
PPAAKLRPPPEGSAGACAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGP
GPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQTPP
FVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPPAA
AQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKTVVQAAPPAAQTLA
ASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGATGAVTQSLPRTPTATTSG
IRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHA
QPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQR
SPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLST
LIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLP
ALRQLTPDSAAFIQQSQQQPPPPASQATTALTAVVLSSSVQRTAGKTAATVTSALQPPVL
SLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQ
IQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAG
VNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVSYV
SHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQE
REILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDC
PGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKA
FLK
Download sequence
Identical sequences H2REF4
ENSPTRP00000059890 ENSPTRP00000023561 XP_514759.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]