SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060125 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060125
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.27e-20
Family ADP-ribosylglycohydrolase 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060125   Gene: ENSPTRG00000041400   Transcript: ENSPTRT00000072516
Sequence length 88
Comment pep:known chromosome:CHIMP2.1.4:13:114169456:114174777:-1 gene:ENSPTRG00000041400 transcript:ENSPTRT00000072516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGFGAATKAMCIGLRYWKPERLETLIEVSVECGRMTHNHPTGFLGSLCTALFVSFAAQGK
PLVQWGRDMLRAVPLAEEYCRKTIRHTA
Download sequence
Identical sequences ENSPTRP00000060125 ENSPTRP00000060125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]