SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060186 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060186
Domain Number 1 Region: 56-163
Classification Level Classification E-value
Superfamily Histone-fold 3.71e-35
Family Nucleosome core histones 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060186   Gene: ENSPTRG00000042087   Transcript: ENSPTRT00000074468
Sequence length 176
Comment pep:known_by_projection chromosome:CHIMP2.1.4:X:104470277:104471234:-1 gene:ENSPTRG00000042087 transcript:ENSPTRT00000074468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWHTKFPPTLPLSTTVIVCSCHPVATASTMAEAFSKTTSEEDQSIQEPKEANSMTAQKQK
KGLRGSRRRHANSGGDIFGDSFAAYFPRVLKQVHQALSLSQEAVSVMDSMVRDILDRIAT
EAGHLAHNSKCVTITSRDIRMAVCLLLPGKMGKLAESQGTNATLRTSLCAIWQERK
Download sequence
Identical sequences ENSPTRP00000060186 ENSPTRP00000060186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]