SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060497 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060497
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Histone-fold 6.74e-48
Family Nucleosome core histones 0.00000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060497   Gene: ENSPTRG00000004723   Transcript: ENSPTRT00000076329
Sequence length 129
Comment pep:known chromosome:CHIMP2.1.4:12:15055010:15055652:1 gene:ENSPTRG00000004723 transcript:ENSPTRT00000076329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESQKTKSK
Download sequence
Identical sequences A0A024RAS2 A0A287ANS6 A0A2K5HCR1 G3RQE0 G3U1G6 H2RG51 L8I372 Q3ZBX9 Q9BTM1 W5QGA9
gi|29553970|ref|NP_808760.1| ENSP00000373730 ENSP00000373730 ENSP00000438553 ENSOARP00000021758 ENSBTAP00000040641 ENSDNOP00000033155 9606.ENSP00000373730 9913.ENSBTAP00000040641 ENSBTAP00000040641 ENSPTRP00000060497 ENSLAFP00000021674 ENSPTRP00000060497 ENSLAFP00000021674 ENSP00000373730 ENSP00000438553 NP_001071557.1.59421 NP_001071557.1.76553 NP_808760.1.87134 NP_808760.1.92137 XP_003405713.1.64505 XP_004006885.1.66739 XP_004387393.1.4749 XP_004460376.1.11602 XP_004611358.1.94378 XP_005903678.1.15283 XP_005954919.1.78601 XP_006055195.1.26621 XP_006866097.1.41390 XP_006888491.1.29581 XP_007942660.1.48129 XP_010857024.1.44457 XP_012006296.1.54773 XP_013853268.2.46622 XP_017903936.1.57651 XP_019817071.1.53367 XP_020742966.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]