SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060557 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060557
Domain Number 1 Region: 96-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000131
Family VPS37 C-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060557   Gene: ENSPTRG00000039991   Transcript: ENSPTRT00000074639
Sequence length 322
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:58958022:58988263:-1 gene:ENSPTRG00000039991 transcript:ENSPTRT00000074639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLKDKTLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAERNLEFQGPL
EISRSNLSDKYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAE
KFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPPPVR
PVPQGTPPVVEEQPQPPSAMPPYPLPYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYSRP
LGPTYPAAQPGPRGAAGYSWSPQRSMPPRPGYPGTPTGASGPGYPLGGGRAPSPGYPQQS
PYPATGGKPPYPIQPQLPFSLC
Download sequence
Identical sequences ENSPTRP00000060557 ENSPTRP00000060557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]