SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060583 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060583
Domain Number 1 Region: 29-184
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 2.35e-82
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000816
Further Details:      
 
Domain Number 2 Region: 189-326
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.27e-28
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060583   Gene: ENSPTRG00000012938   Transcript: ENSPTRT00000072803
Sequence length 366
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:224133483:224138746:-1 gene:ENSPTRG00000012938 transcript:ENSPTRT00000072803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLCCLVVPAAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARS
SERFMELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWD
EDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEH
SAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLWGRMGAPPVLIFLDRDPQEFQVIE
TQDPPRRLALTPAHLLFTADNHTEPAPAPGHICQPRAGQYVLVAGVPGLQPARVAAVSTH
VALGAYAPLTRHGTLVVEDVVASCFAAVADHHLAQLAFWPLRLFHRHGALDPGGGVHWYP
QLLYRL
Download sequence
Identical sequences ENSPTRP00000060583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]