SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060794 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060794
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily Histone-fold 1.24e-59
Family Nucleosome core histones 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060794   Gene: ENSPTRG00000041656   Transcript: ENSPTRT00000075122
Sequence length 126
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:28108050:28108480:1 gene:ENSPTRG00000041656 transcript:ENSPTRT00000075122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
Download sequence
Identical sequences A0A024RCJ9 A0A0D9SCK0 A0A2K6AJ28 A0A2K6RPU8 A0A2K6S7Z2 F2Z4E8 F6PWV1 G1QS97 G3U082 L5JTI9 L8HY81 Q99877
ENSECAP00000003529 ENSDORP00000008228 ENSSSCP00000024052 ENSVPAP00000003983 ENSECAP00000003529 ENSTBEP00000008446 ENSP00000380177 NP_003511.1.87134 NP_003511.1.92137 XP_003363834.1.31192 XP_003421147.1.64505 XP_003776824.1.23681 XP_003944786.1.74449 XP_004019076.1.66739 XP_004043517.1.27298 XP_004286149.1.21590 XP_004441828.1.5094 XP_004847599.1.39548 XP_005701748.2.57651 XP_005906210.1.15283 XP_005960024.1.78601 XP_006045701.1.26621 XP_006215322.1.17985 XP_006888686.1.29581 XP_006923515.1.64745 XP_006923546.1.64745 XP_007105892.1.24612 XP_007105893.1.24612 XP_007179130.1.59432 XP_007449310.1.90284 XP_007971594.1.81039 XP_008953277.1.60992 XP_009239810.1.23681 XP_009239811.1.23681 XP_009239812.1.23681 XP_009239813.1.23681 XP_010372554.1.97406 XP_011756525.1.29376 XP_011756526.1.29376 XP_011800320.1.43180 XP_011846632.1.47321 XP_011846633.1.47321 XP_011931488.1.92194 XP_012014272.1.54773 XP_012321310.1.9421 XP_012358678.1.23891 XP_012414118.1.4749 XP_014684672.1.49734 XP_014991252.1.72884 XP_015305253.1.63531 XP_015989188.1.101085 XP_016021799.1.101085 XP_016810557.1.37143 XP_017744641.1.44346 XP_019569758.1.88060 XP_019800469.1.83887 XP_019800470.1.83887 XP_020006755.1.5219 ENSVPAP00000003983 ENSP00000380177 ENSP00000446031 ENSP00000483903 ENSSSCP00000024052 ENSPTRP00000060794 gi|4504261|ref|NP_003511.1| ENSLAFP00000021240 ENSTBEP00000008446 ENSGGOP00000026004 ENSNLEP00000022656 ENSPVAP00000014785 ENSPVAP00000015565 ENSPTRP00000060794 ENSPVAP00000014785 ENSPVAP00000015565 ENSTTRP00000012767 ENSDORP00000008228 ENSBTAP00000042634 ENSBTAP00000042634 ENSLAFP00000021240 ENSTTRP00000012767 ENSNLEP00000022656 ENSP00000380177 ENSP00000446031 ENSGGOP00000026004 9598.ENSPTRP00000050476 9606.ENSP00000380177 9796.ENSECAP00000003529 9823.ENSSSCP00000001243 9913.ENSBTAP00000042634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]